다른 상품 둘러보기
Anti-CELSR2 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-Multiple epidermal growth factor-like domains 3, Anti-Cadherin EGF LAG seven-pass G-type receptor 2 precursor, Anti-Flamingo 1, Anti-Epidermal growth factor-like 2
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunohistochemistry: 1:20- 1:50
면역원 서열
SATQDVHFTENLLRVGSALLDTANKRHWELIQQTEGGTAWLLQHYEAYASALAQNMRHTYLSPFTIVTPNIVISVVRLDKGNFAGAKLPRYEALRGEQPPDLETTVILPESVFRETPPVVRPAGPGEAQEPEELARRQRRHPELSQ
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... CELSR2(1952)
The gene CELSR2 (cadherin, EGF LAG seven-pass G-type receptor 2) encodes a member of the flamingo subfamily that comprises of nonclassic-type cadherins. The gene is mapped to human chromosome 1. It is also referred to as EGFL2 (epidermal growth factor (EGF)-like 2) and contains EGF-like repeats and cadherin repeat motifs. The encoded protein is 2923 amino acids in length and is 94% identical to mouse Flamingo protein. Its expression is strongest in the brain.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|