
Merck Anti-CA4 antibody produced in rabbit
Rabbit에서 생산된 Anti-CA4 항체로, 인간 Carbonic anhydrase IV 단백질을 인식하는 polyclonal 항체입니다. Prestige Antibodies® 라인 제품으로, 면역조직화학(IHC)에 적합하며 −20°C에서 보관합니다. 25 μL 소포장으로 제공됩니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CA4 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
Synonyms
Anti-Carbonate dehydratase IV, Anti-CA-IV, Anti-Carbonic anhydrase IV, Anti-Carbonic anhydrase 4 precursor
제품 정보
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| Quality Level | 100 |
| 결합 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| 항체 타입 | Primary antibodies |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 형태 | Buffered aqueous glycerol solution |
| Species Reactivity | Human |
| 포장 | 25 μL (small pack) |
| 적용 기술 | Immunohistochemistry (IHC): 1:200–1:500 |
| 면역원 서열 | VTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLA |
| UniProt 수납 번호 | P22748 |
| 배송 상태 | Wet ice |
| 저장 온도 | −20°C |
Gene Information
CA4 (carbonic anhydrase IV) is a member of the zinc metalloprotein family called carbonic anhydrases, consisting of 16 members.
This protein is anchored to the plasma membrane through a glycosyl-phosphatidyl-inositol (GPI) moiety and has a molecular weight of approximately 35 kDa.
It is synthesized as a precursor of 312 amino acids in the endoplasmic reticulum and resides in the plasma membrane of endothelial and epithelial cells of multiple organs.
The CA4 gene maps to human chromosome 17q23, spans 9.5 kb, and contains seven introns and eight exons.
🏷️Merck Sigma 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Merck Sigma
Merck Anti-ARSI antibody produced in rabbit
895,700원

Merck Sigma
Merck Anti-CSNK2B antibody produced in rabbit
817,800원

Merck Sigma
Merck Anti-CA4 antibody produced in rabbit
895,700원

Merck Sigma
Merck Anti-SLC25A11 antibody produced in rabbit
370,530원

Merck Sigma
Merck Anti-KRT9 antibody produced in rabbit
895,700원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|