Merck Anti-CA4 antibody produced in rabbit
상품 옵션 정보 | |||||||||
---|---|---|---|---|---|---|---|---|---|
카탈로그 번호 | CAS 번호 | 설명 | 상태 | 재고 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
HPA011089-100UL | - | Merck HPA011089-100UL Anti-CA4 antibody produced in rabbit, 100uL pk | 재고문의 | 0 | pk | 895,700원 | - | 985,270원 |
다른 상품 둘러보기
Anti-CA4 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-Carbonate dehydratase IV, Anti-CA-IV, Anti-Carbonic anhydrase IV, Anti-Carbonic anhydrase 4 precursor
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunohistochemistry: 1:200- 1:500
면역원 서열
VTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLA
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... CA4(762)
CA4 (carbonic anhydrase IV) is a member of zinc metalloprotein family called carbonic anhydrases, which is made of 16 members. This protein is anchored to the plasma membrane through glycosyl-phosphatiydyl-inositol (GPI) moiety. It has a molecular weight of 35kDa. It is synthesized as a precursor of 312 amino acids, in endoplasmic reticulum and resides in the plasma membrane of endothelial and epithelial cells of multiple organs. This gene maps to human chromosome 17q23, spans 9.5kb, and has seven introns and eight exons.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|