Merck Anti-CA4 antibody produced in rabbit
Rabbit에서 생산된 Anti-CA4 항체로, 인간 Carbonic anhydrase IV 단백질을 인식하는 polyclonal 항체입니다. Prestige Antibodies® 라인 제품으로, 면역조직화학(IHC)에 적합하며 −20°C에서 보관합니다. 25 μL 소포장으로 제공됩니다.
- 브랜드
- Merck Sigma
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Merck Sigma · Merck Anti-CA4 antibody produced in rabbit
Anti-CA4 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
Synonyms
Anti-Carbonate dehydratase IV, Anti-CA-IV, Anti-Carbonic anhydrase IV, Anti-Carbonic anhydrase 4 precursor
제품 정보
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| Quality Level | 100 |
| 결합 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| 항체 타입 | Primary antibodies |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 형태 | Buffered aqueous glycerol solution |
| Species Reactivity | Human |
| 포장 | 25 μL (small pack) |
| 적용 기술 | Immunohistochemistry (IHC): 1:200–1:500 |
| 면역원 서열 | VTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLA |
| UniProt 수납 번호 | P22748 |
| 배송 상태 | Wet ice |
| 저장 온도 | −20°C |
Gene Information
CA4 (carbonic anhydrase IV) is a member of the zinc metalloprotein family called carbonic anhydrases, consisting of 16 members.
This protein is anchored to the plasma membrane through a glycosyl-phosphatidyl-inositol (GPI) moiety and has a molecular weight of approximately 35 kDa.
It is synthesized as a precursor of 312 amino acids in the endoplasmic reticulum and resides in the plasma membrane of endothelial and epithelial cells of multiple organs.
The CA4 gene maps to human chromosome 17q23, spans 9.5 kb, and contains seven introns and eight exons.
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.