Merck Anti-SLC2A12 antibody produced in rabbit
다른 상품 둘러보기
Anti-SLC2A12 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-GLUT8, Anti-TYP, Anti-MKP-2, Anti-HVH2, Anti-solute carrier family 2 (facilitated glucose transporter), member 12, Anti-GLUT12
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunohistochemistry: 1:20- 1:50
면역원 서열
PSPRFLVMKGQEGAASKVLGRLRALSDTTEELTVIKSSLKDEYQYSFWDLFRSKDNMRTR
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... SLC2A12(154091)
SLC2A12 (solute carrier family 2 member 12) gene is mapped to human chromosome 6q23.2. The members of the family SLC2A12 are also termed as GLUTS (glucose transporter 12). The encoded protein GLUT12 belongs to class III group of facilitative glucose transporter family. Facilitative glucose transporters include the general GLUT isoforms that include GLUT1–5 and novel GLUT isoforms which comprises of GLUT6–14. GLUT12 is known to be expressed in adipose tissue and vascular smooth muscle.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제수단 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|