Merck Anti-MAGI2 antibody produced in rabbit
다른 상품 둘러보기
Anti-MAGI2 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2, Anti-Atrophin-1-interacting protein 1, Anti-Atrophin-1-interacting protein A, Anti-MAGI-2, Anti-Membrane-associated guanylate kinase inverted 2
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunohistochemistry: 1:200- 1:500
면역원 서열
AEGKRKRNKSVSNMEKASIEPPEEEEEERPVVNGNGVVVTPESSEHEDKSAGASGEMPSQPYPAPVYSQPEELKEQMDDTKPTKPEDNEEPDPLPDNWEMA
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... MAGI2(9863)
The gene MAGI2 (membrane associated guanylate kinase, WW and PDZ domain containing 2) is mapped to human chromosome 7q21 and spans 1.4 megabases. It contains 21 exons encoding a 2410 amino acid protein that contains nine potential protein-protein interaction domains. These domains include one Guk (guanylate kinase-like) domain, two WW domains and six PDZ domains.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.