상품 옵션 정보 | |||||||
---|---|---|---|---|---|---|---|
카탈로그 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
HPA005131-100UL | Merck HPA005131-100UL Anti-REN antibody produced in rabbit, 100uL pk | 재고문의 | pk | 894,810원 | - | 984,291원 |
Anti-REN antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-Angiotensinogenase antibody produced in rabbit, Anti-Renin precursor antibody produced in rabbit
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunohistochemistry: 1:50- 1:200
면역원 서열
FHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFD
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... REN(5972)
REN gene encodes the enzyme renin, which is expressed mainly by the granular cells of the kidney in the juxtaglomerular apparatus. REN gene is 12.5kb in length and is localised to the chromosomal region 1q32. Renin is a protease enzyme, which cleaves at the aspartate residue and is synthesised as prorenin. Prorenin includes an additional 43 amino acid fragment at the N-terminal. Renin has a molecular weight of 37kDa and is composed of 340 amino acids. There is evidence that renin is also expressed in ovary, testis, submandibular gland, adrenal gland, brain, heart etc.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|