
Merck Anti-FUT2 antibody produced in rabbit
토끼에서 생산된 Anti-FUT2 폴리클로날 항체로 인간 FUT2 단백질을 인식합니다. Prestige Antibodies® Powered by Atlas Antibodies 제품으로 높은 특이성과 품질을 보장합니다. 면역조직화학(IHC)에 1:200~1:500 희석 비율로 사용 가능합니다. 버퍼된 글리세롤 용액 형태로 −20°C에서 보관합니다.
- 브랜드
- Merck Sigma
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Merck Sigma · Merck Anti-FUT2 antibody produced in rabbit
Anti-FUT2 antibody produced in rabbit
제품 개요
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated primary antibody (rabbit origin)
Buffered aqueous glycerol solution
다른 명칭
Anti-SE2, Anti-Secretor factor, Anti-Fucosyltransferase 2, Anti-Secretor blood group alpha-2-fucosyltransferase,
Anti-Alpha(1,2)FT 2, Anti-Galactoside 2-alpha-L-fucosyltransferase 2, Anti-Se,
Anti-GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 2
제품 사양
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| 품질 등급 | 100 (M-Clarity Program) |
| 결합 형태 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| 항체 유형 | Primary antibody |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 제형 | Buffered aqueous glycerol solution |
| 반응 종 | Human |
| 포장 단위 | Small pack, 25 μL |
| 적용 기술 | Immunohistochemistry (IHC): 1:200–1:500 |
| 면역원 서열 | QRLAKIQAMWELPVQIPVLASTSKALGPSQLRGMWTINAIGRLGNQMGEYATLYALAKMNGRPAFIPAQMHSTL |
| UniProt 번호 | Q10981 |
| 배송 상태 | Wet ice |
| 저장 온도 | −20°C |
유전자 정보
Gene: human FUT2 (fucosyltransferase 2) [FUT2(2524)]
The FUT2 gene (9,980 bp) is mapped to human chromosome 19q13.3.
It contains two exons separated by an intron of 6,865 bp.
제품 이미지
Merck Sigma 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



