Merck Anti-FUT2 antibody produced in rabbit
토끼에서 생산된 Anti-FUT2 폴리클로날 항체로 인간 FUT2 단백질을 인식합니다. Prestige Antibodies® Powered by Atlas Antibodies 제품으로 높은 특이성과 품질을 보장합니다. 면역조직화학(IHC)에 1:200~1:500 희석 비율로 사용 가능합니다. 버퍼된 글리세롤 용액 형태로 −20°C에서 보관합니다.
- 브랜드
- Merck Sigma
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Merck Sigma · Merck Anti-FUT2 antibody produced in rabbit
Anti-FUT2 antibody produced in rabbit
제품 개요
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated primary antibody (rabbit origin)
Buffered aqueous glycerol solution
다른 명칭
Anti-SE2, Anti-Secretor factor, Anti-Fucosyltransferase 2, Anti-Secretor blood group alpha-2-fucosyltransferase,
Anti-Alpha(1,2)FT 2, Anti-Galactoside 2-alpha-L-fucosyltransferase 2, Anti-Se,
Anti-GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 2
제품 사양
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| 품질 등급 | 100 (M-Clarity Program) |
| 결합 형태 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| 항체 유형 | Primary antibody |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 제형 | Buffered aqueous glycerol solution |
| 반응 종 | Human |
| 포장 단위 | Small pack, 25 μL |
| 적용 기술 | Immunohistochemistry (IHC): 1:200–1:500 |
| 면역원 서열 | QRLAKIQAMWELPVQIPVLASTSKALGPSQLRGMWTINAIGRLGNQMGEYATLYALAKMNGRPAFIPAQMHSTL |
| UniProt 번호 | Q10981 |
| 배송 상태 | Wet ice |
| 저장 온도 | −20°C |
유전자 정보
Gene: human FUT2 (fucosyltransferase 2) [FUT2(2524)]
The FUT2 gene (9,980 bp) is mapped to human chromosome 19q13.3.
It contains two exons separated by an intron of 6,865 bp.
제품 이미지
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.