Anti-EPHX2 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab1
Anti-Epoxide hydrolase 2, Anti-Epoxide hydratase, Anti-SEH, Anti-CEH, Anti-Soluble epoxide hydrolase, Anti-Cytosolic epoxide hydrolase
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500
면역원 서열
YRNMERNWKWACKSLGRKILIPALMVTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLDSDAR
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... EPHX2(2053)
EPHX2 (epoxide hydrolase 2) is widely expressed with strong expression in the liver and kidney. The protein is a homodimer. It has two domains: an amino terminal domain with α/β hydrolase fold responsible for the catalytic activity and a carboxyl terminal domain with α/β fold belonging to the haloacid dehalogenase superfamily of enzymes. The gene is mapped to human chromosome 8p21.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|