
Merck Anti-GRIK2 antibody produced in rabbit
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-GRIK2 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-Glutamate receptor 6, Anti-GluR-6, Anti-Excitatory amino acid receptor 4, Anti-EAA4, Anti-Glutamate receptor, ionotropic kainate 2 precursor, Anti-GluR6
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
mouse, human, rat
포장
antibody small pack of 25 μL
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:1000-1:2500
면역원 서열
ITFNKTNGLRTDFDLDVISLKEEGLEKIGTWDPASGLNMTESQKGKPANITDSLSNRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLL
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... GRIK2(2898)
GRIK2 (glutamate receptor, ionotropic, kainate 2) is a kainate type receptor, belonging to the family of glutamate ion channel receptors. Kainate receptor subtype contains five member subunits naming from GLUK1 to GLUK5. GRIK2 is also called GluK2 or GluR6. This protein has three different isoforms, differing in their C-termini. The longest isoform called GluK2a is composed of 908 amino acids. This gene is localized to human chromosome 6, spans ~670kb, and has 17 exons. The corresponding mRNA is expressed in dentate gyrus, cornu ammonis 3 (CA3) in the pyramidal neurons, cell layer of cerebellar granule, and neocortical regions of the brain.
🏷️Merck Sigma 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Merck Sigma
Merck Anti-Akt1/PKBα Antibody
206,000원

Merck Sigma
Merck Anti-POLE2 antibody produced in rabbit
370,530원

Merck Sigma
Merck Anti-GRIK2 antibody produced in rabbit
895,700원

Merck Sigma
Merck Monoclonal Anti-MBP antibody produced in mouse
817,800원

Merck Sigma
Merck Anti-PAPD5 antibody produced in rabbit
370,530원
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제수단 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|