Anti-CARMIL2 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-Lrrc16c, Anti-Rgd motif, leucine rich repeats, tropomodulin domain and proline-rich containing, Anti-RLTPR, Anti-LRRC16C, Anti-Carmil2
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunohistochemistry: 1:50- 1:200
면역원 서열
EVNELCQSVQEHVELLGCGAGPQGEAAVRQAEDAIQNANFSLSILPILYEAGSSPSHHWQLGQKLEGLLRQVGEVCRQDIQDFTQ
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... RLTPR(146206)
The gene CARMIL2 (capping protein regulator and myosin 1 linker 2) is mapped to human chromosome 16q22.1. The encoded protein belongs to the CARMIL family of proteins. The protein has a noncanonical pleckstrin homology domain, a leucine-rich repeat domain, a helical homodimerization domain and a disordered region that contains the CBR (CP-binding region) and a proline-rich domain, which binds to class-I myosins. CARMIL2 is also referred to as RLTPR (RGD, leucine-rich repeat, tropomodulin and proline-rich-containing protein).
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|