Merck Anti-AREG antibody produced in rabbit
토끼에서 생산된 Anti-AREG 다클론 항체로, 인간 AREG 단백질을 특이적으로 인식합니다. Prestige Antibodies® 제품군으로 높은 품질을 보장하며, 면역조직화학(IHC)에 적합합니다. 버퍼링된 글리세롤 용액 형태로 제공되며 −20°C에서 보관합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-AREG antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
Synonyms: Anti-SDGF, Anti-AREGB, Areg Antibody
제품 정보
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| Quality Level | 100 |
| 결합 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| Antibody Product Type | Primary antibodies |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 형태(Form) | Buffered aqueous glycerol solution |
| Species Reactivity | Human |
| 포장 단위 | 25 μL (small pack) |
| 적용 기술(Technique) | Immunohistochemistry (IHC): 1:500–1:1000 |
| 면역원 서열 (Immunogen Sequence) | FSGDHSADGFEVTSRSEMSSGSEISPVSEMPSSSEPSSGADYDYSEEYDNEPQIPGYIVDDSVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERC |
| UniProt 수납 번호 | P15514 |
| 배송 상태 | Wet ice |
| 저장 온도 | −20°C |
Gene Information
Gene: AREG (374)
Amphiregulin is a protein encoded by the AREG gene in humans and is mapped to chromosomal region 4q13–4q21. It acts as a ligand for the epidermal growth factor receptor (EGFR), a transmembrane tyrosine kinase. Amphiregulin functions as a bifunctional cell growth modulator composed of 78 amino acids. The amino-terminal region is hydrophilic, while the carboxyl-terminal region shows homology to the EGF family. It is mainly expressed in the human placenta and ovaries and may play a role in regulating normal cell growth. Amphiregulin is synthesized as a membrane-anchored precursor protein, and its expression is induced by various stimuli including inflammatory lipids, cytokines, hormones, growth factors, and xenobiotics.
🏷️Merck Sigma 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Merck Sigma
Merck Anti-ITPKC antibody produced in rabbit
370,530원
Merck Sigma
Merck Anti-MIXL1 antibody produced in rabbit
817,800원
Merck Sigma
Merck Anti-AREG antibody produced in rabbit
370,530원
Merck Sigma
Merck Anti-ZNF189 antibody produced in rabbit
895,700원
Merck Sigma
Merck Anti-VDAC1 antibody produced in rabbit
817,800원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|