CacheBy
Merck Anti-AREG antibody produced in rabbit
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Merck Anti-AREG antibody produced in rabbit

상품 한눈에 보기

토끼에서 생산된 Anti-AREG 다클론 항체로, 인간 AREG 단백질을 특이적으로 인식합니다. Prestige Antibodies® 제품군으로 높은 품질을 보장하며, 면역조직화학(IHC)에 적합합니다. 버퍼링된 글리세롤 용액 형태로 제공되며 −20°C에서 보관합니다.

브랜드
Merck Sigma

Merck Sigma · Merck Anti-AREG antibody produced in rabbit

Anti-AREG antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies

Affinity isolated antibody, buffered aqueous glycerol solution

Synonyms: Anti-SDGF, Anti-AREGB, Areg Antibody


제품 정보

항목 내용
생물학적 소스 Rabbit
Quality Level 100
결합 Unconjugated
항체 형태 Affinity isolated antibody
Antibody Product Type Primary antibodies
클론 Polyclonal
제품 라인 Prestige Antibodies® Powered by Atlas Antibodies
형태(Form) Buffered aqueous glycerol solution
Species Reactivity Human
포장 단위 25 μL (small pack)
적용 기술(Technique) Immunohistochemistry (IHC): 1:500–1:1000
면역원 서열 (Immunogen Sequence) FSGDHSADGFEVTSRSEMSSGSEISPVSEMPSSSEPSSGADYDYSEEYDNEPQIPGYIVDDSVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERC
UniProt 수납 번호 P15514
배송 상태 Wet ice
저장 온도 −20°C

Gene Information

Gene: AREG (374)
Amphiregulin is a protein encoded by the AREG gene in humans and is mapped to chromosomal region 4q13–4q21. It acts as a ligand for the epidermal growth factor receptor (EGFR), a transmembrane tyrosine kinase. Amphiregulin functions as a bifunctional cell growth modulator composed of 78 amino acids. The amino-terminal region is hydrophilic, while the carboxyl-terminal region shows homology to the EGF family. It is mainly expressed in the human placenta and ovaries and may play a role in regulating normal cell growth. Amphiregulin is synthesized as a membrane-anchored precursor protein, and its expression is induced by various stimuli including inflammatory lipids, cytokines, hormones, growth factors, and xenobiotics.

Merck Sigma 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.