
Merck Anti-IGF2R antibody produced in rabbit
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-IGF2R antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-CI Man-6-P receptor, Anti-IGF-II receptor, Anti-Insulin-like growth factor II receptor, Anti-M6P/IGF2 receptor, Anti-M6P/IGF2R, Anti-300 kDa mannose 6-phosphate, Anti-Insulin-like growth factor 2 receptor, Anti-Cation-independent mannose-6-phosphate receptor precursor, Anti-M6PR, Anti-CI-MPR
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500
면역원 서열
CKKDIFKANKEVPCYVFDEELRKHDLNPLIKLSGAYLVDDSDPDTSLFINVCRDIDTLRDPGSQLRACPPGTAACLVRGHQAFDVGQPRDGLKLVRKDRLVLSYVREEAGKLDFCDGHSPAVTITFVCPSE
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... IGF2R(3482)
IGF2R (insulin-like growth factor 2 receptor) is a transmembrane glycoprotein. It is one of the two mannose 6-phosphate (M6P) receptors found in mammalian cells. It has 15 consecutive repeating regions making up a repetitive structure. The domains 3 and 9 contain M6P-binding sites. Domain 5 contains M6P-N-acetylglucosamine residue- binding site. The IGF-II binding site is located in domain 11. It belongs to p-lectin family and has a molecular weight of 300kDa. It has an N-terminal, a small cytosolic C-terminal, a transmembrane region and a large exosolic domain.
🏷️Merck Sigma 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Merck Sigma
Merck Anti-FMNL3 antibody produced in rabbit
370,530원

Merck Sigma
Merck Anti-LIG4 antibody produced in rabbit
370,530원

Merck Sigma
Merck Anti-IGF2R antibody produced in rabbit
370,530원

Merck Sigma
Merck Anti-Na+/K+ ATPase α-1 Antibody, clone C464.6, Alexa Fluor 555
218,400원

Merck Sigma
Merck Anti-MFN2 antibody produced in rabbit
370,530원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
