Anti-PNPLA7 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-patatin-like phospholipase domain containing 7 antibody produced in rabbit, Anti-PNPLA7), mRNA antibody produced in rabbit
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunohistochemistry: 1:50- 1:200
면역원 서열
CEVGYQHGRTVFDIWGRSGVLEKMLRDQQGPSKKPASAVLTCPNASFTDLAEIVSRIEPAKPAMVDDESDYQTEYEEELLDVPRDAYADFQSTSAQQGSDLEDESSLRHRHPSLAFPKLSE
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... PNPLA7(375775)
PNPLA7 (patatin like phospholipase domain containing 7) belongs to the hormone-sensitive superfamily of lipases called PNPLA. This protein is thought to contain a single transmembrane domain and one or more tyrosine kinase phosphorylation sites. It also contains putative cyclic nucleotide binding sites. It is widely expressed with major expression in adipose, pancreatic and prostate tissues. This protein further clusters into the NTE (neuropathy target esterase) subfamily. Humans contain nine members of PNPLA family. This gene localizes to human chromosome 9q34.3.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|