상품 옵션 정보 | ||||||||
---|---|---|---|---|---|---|---|---|
카탈로그 번호 | CAS 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
HPA026790-100UL | - | Merck HPA026790-100UL Anti-RNF213 antibody produced in rabbit, 100uL pk | 재고문의 | pk | 868,530원 | - | 955,383원 |
Anti-RNF213 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-pNR-2, Anti-D21S21, Anti-HPS2, Anti-HP1.A, Anti-ring finger protein 213, Anti-KIAA1554, Anti-BCEI, Anti-C17orf27, Anti-KIAA1618, Anti-NET57, Anti-pS2
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunohistochemistry: 1:50- 1:200
면역원 서열
KDPVCLPCDHVHCLRCLRAWFASEQMICPYCLTALPDEFSPAVSQAHREAIEKHARFRQMCNSFFVDLVSTICFKDNAPPEKEVIESLLSLLFVQKGRLRDAAQRHCEHTKSLSPFNDVVDKTPVIRSVILKLLLKYS
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... RNF213(57674)
The ring finger protein 213 (RNF213) gene is mapped around 137,922-bp region on chromosome 17q25.3. This gene with 67 protein coding exons codes for 596kDa protein RNF213, which is predominantly expressed in spleen and leukocytes. The encoded protein is characterized with an AAA ATPase domain, α-2-macroglobulin and ring finger domains, which impart both E3 ubiquitin ligase activity and energy-dependent unfoldase property to the protein.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|