Anti-IGSF9B antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-CDNA FLJ40259 fis, clone TESTI2025486. antibody produced in rabbit, Anti-Fragment antibody produced in rabbit
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunohistochemistry: 1:200-1:500
면역원 서열
LEAPLSSGKVSPESIRTLRAPSESSDDQGQPAAKRMLSPTREKELSLYKKTKRAISSKKYSVAKAEAEAEATTPIELISRGPDGRFVMDPAEMEPSLKSRRIEGFPFAEETDMYPEFRQSDEENEDPLVPTSVAALKSQLTPLSSSQE
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... IGSF9B(22997)
IGSF9B (immunoglobulin superfamily, member 9B) is a member of the vertebrate immunoglobulin superfamily (IgSF). This family also includes immunoglobulin superfamily (IgSF), member 9 (IGSF9/Dasm1), which is a homologue of Drosophila protein Turtle. It is a hemophilic adhesion molecule, which is exclusively expressed in brain, especially in GABAergic interneurons. It has a C-terminal PDZ-binding domain, a transmembrane domain, five immunoglobulin (Ig) domains and two fibronectin III (FNIII) domains. It is predominantly localized at the inhibitory synapses.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|