Anti-TNFRSF1B antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-p75 antibody produced in rabbit, Anti-p80 TNF-α receptor antibody produced in rabbit, Anti-Tumor necrosis factor receptor superfamily member 1B precursor antibody produced in rabbit, Anti-CD120b antigen antibody produced in rabbit, Anti-Etanercept antibody produced in rabbit, Anti-Tumor necrosis factor receptor 2 antibody produced in rabbit, Anti-TNF-R2 antibody produced in rabbit, Anti-Tumor necrosis factor receptor type II antibody produced in rabbit
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200
면역원 서열
HAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVV
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... TNFRSF1B(7133)
TNFRSF1B (tumor necrosis factor receptor superfamily, member 1B) is a member of tumor necrosis factor (TNF) receptor (TNFR) superfamily. It plays a vital role in the immune homeostasis by controlling cell death or apoptosis.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.