Anti-BIRC2 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-Inhibitor of apoptosis protein 2, Anti-HIAP2, Anti-RING finger protein 48, Anti-HIAP-2, Anti-IAP homolog B, Anti-C-IAP1, Anti-Baculoviral IAP repeat-containing protein 2, Anti-TNFR2-TRAF-signaling complex protein 2
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human, rat
포장
antibody small pack of 25 μL
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200
면역원 서열
NWKLGDSPIQKHKQLYPSCSFIQNLVSASLGSTSKNTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSYAMSTEEARFLTYHMWPLTFLSPSELARAGF
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... BIRC2(329)
BIRC2 (baculoviral IAP repeat containing 2) is a member of the inhibitor of apoptosis protein (IAP) family. It is expressed almost exclusively in nucleus, which is mediated by its Bir domains. BIRC2 is a RING finger ubiquitin ligase (E3). This gene is localized to chromosome 11q22.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.