| 상품 옵션 정보 | |||||||
|---|---|---|---|---|---|---|---|
| 카탈로그 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
| HPA008874-100UL | Merck HPA008874-100UL Anti-FDFT1 antibody produced in rabbit, 100uL pk | 재고문의 | pk | 948,780원 | - | 1,043,658원 | |
Anti-FDFT1 antibody produced in rabbit
affinity isolated antibody, buffered aqueous glycerol solution
Anti-FPP:FPP farnesyltransferase antibody produced in rabbit, Anti-Squalene synthetase antibody produced in rabbit, Anti-SQS antibody produced in rabbit, Anti-Farnesyl-diphosphate farnesyltransferase antibody produced in rabbit, Anti-SS antibody produced in rabbit
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200
면역원 서열
PEEFYNLVRFRIGGKRKVMPKMDQDSLSSSLKTCYKYLNQTSRSFAAVIQALDGEMRNAVCIFYLVLRALDTLEDDMTISVEKKVPLLHNFHSFLYQPDWRFMESKEKDRQVLEDFPTISLEFRNLAEKYQTVIADICR
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... FDFT1(2222)
FDFT1 (farnesyl-diphosphate farnesyltransferase 1) is also known as squalene synthase (SS), and is an essential enzyme of the cholesterol biogenesis pathway. This protein has a putative molecular weight of 48,041 and is composed of 417 amino acids. Two variants of FDFT1 mRNA are found in humans, which differ at their 3′ untranslated regions. They are of 2kb and 1.55kb and are equally expressed in heart, lung, liver, kidney, pancreas and placenta. However, the 2kb transcript is abundant in heart and skeletal muscle.
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제 방법 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|