
Merck Anti-SIGLEC1 antibody produced in rabbit
Rabbit에서 생산된 Anti-SIGLEC1 항체로 인간 SIGLEC1(CD169)을 인식합니다. 면역조직화학(IHC)에 적합하며 비결합형 다클론 항체입니다. Affinity 정제된 glycerol buffer 용액 형태로 −20°C에서 보관합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SIGLEC1 antibody produced in rabbit
제품 개요
Affinity isolated antibody, buffered aqueous glycerol solution
타겟: Anti-dJ1009E24.1, Anti-FLJ00051, Anti-sialic acid binding Ig-like lectin 1, sialoadhesin, Anti-FLJ00055, Anti-CD169
생물학적 소스
rabbit
품질 등급
100
결합
unconjugated
항체 형태
affinity isolated antibody
항체 종류
primary antibodies
클론
polyclonal
제형
buffered aqueous glycerol solution
반응 종
human
포장
antibody small pack of 25 μL
적용 기술
immunohistochemistry: 1:200–1:500
면역원 서열
CTAQNLLGSISTIGRLQVEGARVVAEPGLDVPEGAALNLSCRLLGGPGPVGNSTFAWFWNDRRLHAEPVPTLAFTHVARAQAGMYH
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
유전자 정보
human SIGLEC1(6614)
Sialic acid-binding Ig-like lectin 1 (SIGLEC1), also known as CD169, is a myeloid-cell surface receptor belonging to the Siglec family. It is expressed on specific macrophage subsets and precursor monocytes, as well as on some dendritic cells and T lymphocytes. SIGLEC1 is encoded by a gene located on human chromosome 20p. The protein structure contains 17 Ig-like domains, including one N-terminal V-set domain and 16 C2-set domains.
제품 스펙 요약
| 항목 | 내용 |
|---|---|
| Biological Source | Rabbit |
| Quality Level | 100 |
| Conjugation | Unconjugated |
| Antibody Type | Primary, Polyclonal |
| Form | Buffered aqueous glycerol solution |
| Species Reactivity | Human |
| Application | Immunohistochemistry (1:200–1:500) |
| Packaging | 25 μL |
| Storage Temperature | −20°C |
| Shipping Condition | Wet ice |
| UniProt Accession | Q9BZZ2 |
제품 이미지
(이미지 없음)
🏷️Merck Sigma 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Merck Sigma
Merck Anti-Ezrin antibody, Mouse monoclonal
277,300원

Merck Sigma
Merck Anti-APOO antibody produced in rabbit
370,530원

Merck Sigma
Merck Anti-SIGLEC1 antibody produced in rabbit
370,530원

Merck Sigma
Merck Anti-NFKBIE antibody produced in rabbit
370,530원

Merck Sigma
Merck Anti-HINT2 antibody produced in rabbit
895,700원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|