Merck Anti-SIGLEC1 antibody produced in rabbit
다른 상품 둘러보기
Anti-SIGLEC1 antibody produced in rabbit
affinity isolated antibody, buffered aqueous glycerol solution
Anti-dJ1009E24.1, Anti-FLJ00051, Anti-sialic acid binding Ig-like lectin 1, sialoadhesin, Anti-FLJ00055, Anti-CD169
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunohistochemistry: 1:200-1:500
면역원 서열
CTAQNLLGSISTIGRLQVEGARVVAEPGLDVPEGAALNLSCRLLGGPGPVGNSTFAWFWNDRRLHAEPVPTLAFTHVARAQAGMYH
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... SIGLEC1(6614)
Sialic acid-binding Ig-like lectin 1 (SIGLEC1), also known as CD169, is a myeloid-cell surface receptor that belongs to the Siglec family. It is expressed on the surface of specific macrophage subsets and its precursor monocytes. In addition, it also shows its expression on some dendritic cells or T lymphocytes. SIGLEC1 is encoded by the gene mapped to human chromosome 20p. The protein structure is characterized with 17 Ig-like domains, including an N-terminal V-set domain and 16 C2-set domains.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|