Merck Anti-VPS13A antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies 제품으로, rabbit에서 생산된 anti-VPS13A polyclonal antibody입니다. 인간 VPS13A 단백질에 특이적이며, immunohistochemistry(1:50–1:200)에 적합합니다. −20°C에서 보관하며, buffered aqueous glycerol solution 형태로 공급됩니다.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-VPS13A antibody produced in rabbit
Anti-VPS13A antibody produced in rabbit
제품 개요
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution (Ab2)
Anti-Chorea-acanthocytosis protein, Anti-Vacuolar protein sorting-associated protein 13A, Anti-Chorein
생물학적 정보
- Source: Rabbit
- Clonality: Polyclonal
- Conjugation: Unconjugated
- Form: Buffered aqueous glycerol solution
- Product Type: Primary antibody
- Product Line: Prestige Antibodies® Powered by Atlas Antibodies
- Species Reactivity: Human
실험 및 포장 정보
| 항목 | 내용 |
|---|---|
| Technique(s) | Immunohistochemistry (1:50–1:200) |
| Packaging | Small pack, 25 μL |
| Shipping Condition | Wet ice |
| Storage Temperature | −20 °C |
품질 및 참조 정보
| 항목 | 내용 |
|---|---|
| Quality Level | 100 |
| UniProt Accession | Q96RL7 |
| Immunogen Sequence | RPPRFFNEDGVIRPYRLRDGTGNQMLQVMENGRFAKYKYFTHVMINKTDMLMITRRGVLFVTKGTFGQLTCEWQYSFDEFTKEPFIVHGRRLRIEAKERVKSVF |
유전자 정보
Human VPS13A (23230)
VPS13A (Vacuolar protein sorting 13 homolog A, S. cerevisiae) encodes a 360 kDa protein referred to as chorein. It is a member of the VPS13 protein family and located on chromosome 9q21. The gene has two splicing variants and is highly expressed in various tissues such as testis, kidney, spleen, and brain. In neurons, it is distributed in microsomal and synaptosomal fractions, the neuronal perinuclear region, cytoplasm, and fibers.
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.