다른 상품 둘러보기
Anti-CTGF antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, ab2
Anti-connective tissue growth factor, Anti-IGFBP8, Anti-CCN2
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:20-1:50
면역원 서열
LPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALAAYRLEDTFGPDPTMIRANCLVQTTEWSACSKTCGMG
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... CTGF(1490)
The CTGF (connective tissue growth factor) gene is mapped to human chromosome 6q23.2. The encoded protein contains five domains namely, secretory signal peptide, insulin-like growth factor-binding protein, von Willebrand factor type C repeat, thrombospondin type-1 repeat and C-terminal cystine-knot-containing domain. Th gene is broadly expressed in many cells including fibroblasts, myofibroblasts, endothelial cells, smooth muscle cells and some epithelial cell types. It is either released to extracellular matrix or is located on the cell membrane.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|