다른 상품 둘러보기
Anti-STAT6 antibody produced in rabbit
affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
향상된 검증
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500
면역원 서열
VYPPHSHSIPPYQGLSPEESVNVLSAFQEPHLQMPPSLGQMSLPFDQPHPQGLLPCQPQEHAVSSPDPLLCSDVTMVEDSCLSQPVTAFPQGTWIGEDIFPPLLPPTEQDLTKLLLEGQGESGGGSLGAQPLLQPSHYGQSGISMSHMDLR
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... STAT6(6778)
Signal transducers and activators of transcription 6 (STAT6) belongs to the family of DNA binding proteins. It is mainly involved with Interleukin-4 (IL-4)-mediated gene expression. Src homology-2 domain (SH2) domain of STAT6 binds to docking sites of IL-4 receptor α to get tyrosine-phosphorylated by the receptor-associated janus kinase (JAK). This binding activates SATAT6 and it forms homodimer. Further, it translocates to the nucleus for adhering with the high affinity STAT-binding elements (SBE) of IL-4/IL-13.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|