Merck Anti-SLC2A5 antibody produced in rabbit
다른 상품 둘러보기
Anti-SLC2A5 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
향상된 검증
recombinant expression
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:200-1:500
면역원 서열
KALQTLRGWDSVDREVAEIRQEDEAEKAAGFISVLKLFRMRSLRWQ
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... SLC2A5(6518)
Glucose transporters (GLUTs) are a family of transporters that have 12 isoforms. These isoforms differ in function, tissue distribution and developmental regulation. Solute carrier family 2, member 5 (SLC2A5), also called GLUT5 is one such isoform, which is expressed in kidney, sperm cells and small intestine. It is the only transporter in the GLUT family, which is specific for fructose and is incapable of transporting glucose or galactose. The human SLC2A5 gene encodes for a 501 amino acid protein and has 12 exons. In humans, this gene is localized to the short arm of chromosome 1.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|