
Merck Anti-LAT antibody produced in rabbit
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-LAT antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
향상된 검증
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200
면역원 서열
HCHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPWPPAYPPVTSYPPLSQPDLLPIPRSPQPLGGSHRTPSSRRDSDG
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... SPNS1(83985)
LAT (linker for activation of T cells) is a leukocyte type III transmembrane adaptor protein. It is made of 262 amino acids, and has a shorter isoform made of 233 amino acids. It is a lipid raft associated protein, and does so by its two cysteine residues present proximal to the membrane. This protein resides in the plasma membrane as well as intracellular and subsynaptic vesicles. It has a small exoplasmic region, a single membrane spanning domain, and a cytoplasmic region containing nine tyrosine residues. This gene maps to human chromosome 16p11.2, spans 5.7kb and has 11 exons.
🏷️Merck Sigma 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Merck Sigma
Merck Anti-MYH9 antibody produced in rabbit
370,530원

Merck Sigma
Merck Anti-LAT2 antibody produced in rabbit
895,700원

Merck Sigma
Merck Anti-LAT antibody produced in rabbit
817,800원

Merck Sigma
Merck Anti-CCDC50 antibody produced in rabbit
370,530원

Merck Sigma
Merck Anti-STX4 antibody produced in rabbit
895,700원
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제수단 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|