Merck Anti-CC2D1A antibody produced in rabbit
토끼에서 생산된 Anti-CC2D1A 폴리클로날 항체로, 인간 단백질에 반응하며 Western blot 및 면역조직화학에 적합합니다. Prestige Antibodies® 라인 제품으로, 향상된 검증을 거친 고품질 항체입니다. −20°C에서 보관합니다.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-CC2D1A antibody produced in rabbit
Anti-CC2D1A antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
제품 정보
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| 품질 등급 | 100 |
| 결합 상태 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| 항체 유형 | Primary antibodies |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 제형 | Buffered aqueous glycerol solution |
| 종 특이성 | Human |
| 포장 단위 | Small pack of 25 μL |
| 향상된 검증 | Recombinant expression (Antibody Enhanced Validation) |
| 적용 기술 | Immunohistochemistry (1:50–1:200), Western blot (0.04–0.4 μg/mL) |
| 면역원 서열 | NLLASIRKGNAIDEADIPPPVAIGKGPASTPTYSPAPTQPAPRIASAPEPRVTLEGPSATAPASSPGLAKPQMPPGPCSPGPLAQLQSRQRDYKLAALHAKQQGDTTAAARHFRVAKSFDAVLE |
| UniProt 번호 | Q6P1N0 |
| 배송 상태 | Wet ice |
| 저장 온도 | −20 °C |
Gene Information
Gene: CC2D1A (human)
Gene ID: 54862
Coiled-coil and C2 domain containing 1A (CC2D1A) gene encodes a signaling scaffold protein with multiple functions. Also known as Freud-1 (Five prime REpressor Under Dual repression binding protein 1), it belongs to the CC2D1A gene family, which includes the homologous gene CC2D1B (Freud-2). CC2D1A is expressed in the cytosol, centrosome, and nucleus, and is also referred to as Akt kinase-interacting protein 1 (Aki1). The CC2D1A family contains a DM14 domain, a C2 domain, and two conserved motifs, and is localized to chromosome region 19p13.12.
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.