Anti-BCAN antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
향상된 검증
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunohistochemistry: 1:200-1:500
면역원 서열
ACYGDMDGFPGVRNYGVVDPDDLYDVYCYAEDLNGELFLGDPPEKLTLEEARAYCQERGAEIATTGQLYAAWDGGLDHCSPGWLADGSVRYPIVTPSQRCGGGLPGVKTLFLFPNQTGFPNKHSRFNVYCFR
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... BCAN(63827)
BCAN (brevican) gene encodes a chondroitin sulfate proteoglycan that is a member of the aggrecan/versican family. The gene is mapped to human chromosome 1q31. The N-terminal region contains a hyaluronic acid-binding domain. An epidermal growth factor-like repeat, a lectin-like and a complement regulatory protein-like domains are present at the C-terminal region. It is the smallest core protein in this family and is expressed in the developing and adult brain. It is expressed in primary cerebellar astrocytes but not in neurons. The core protein has a molar mass of 145kDa and the N terminally truncated form has a molar mass of 80Da.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|