Merck Anti-ATP2B3 antibody produced in rabbit
다른 상품 둘러보기
Anti-ATP2B3 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
향상된 검증
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500
면역원 서열
IRVVKAFRSSLYEGLEKPESKTSIHNFMATPEFLINDYTHNIPLIDDTDVDENEERLRAPPPPSPNQNNNAIDSGIYLTTHVTKSATSSVFSSSPGSPLHSVETS
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... ATP2B3(492)
ATP2B3 (ATPase, Ca+2 transporting, plasma membrane 3), also called PMCA3 (plasma membrane Ca2+ ATPase), is a PMCA isoform, which, in mammals are encoded by four different genes. It has further isoforms due to alternative splicing. Its cytoplasmic tail is made of N- and C-termini, and it has two large cytosolic loops, and it spans the membrane ten times. The calmodulin (CaM)-binding domain is present in the C-terminal. Human brain is the major site of its expression, and it is abundant in the synaptic regions of the cerebellum.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|