Anti-PPFIBP1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
향상된 검증
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:500-1:1000
면역원 서열
DAQGFSDLEKSPSPTPVMGSPSCDPFNTSVPEEFHTTILQVSIPSLLPATVSMETSEKSKLTPKPETSFEENDGNIILGATVDTQLCDKLLTSSLQKSSSLGNLKKETSDGEKETIQKTSEDRA
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... PPFIBP1(8496)
PPFIBP1 (PPFIA binding protein 1, also referred as liprin-β1) encodes the protein that belongs to the LAR (leukocyte common antigen-related) family of transmembrane protein-tyrosine phosphatases. It is a 105kDa cytosolic protein involved with the axon guidance and mammary gland development. It is composed of a extracellular region with three N-terminal Ig (immunoglobulin)-like domains and fibronectin type III-like domains. It has been reported that metastasis-associated protein S100A4 (S100 calcium binding protein A4) interacts with PPFIBP1 in vivo to induce invasiveness of primary tumors and metastasis.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|