Merck Anti-KLK5 antibody produced in rabbit
다른 상품 둘러보기
Anti-KLK5 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
향상된 검증
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunohistochemistry: 1:50- 1:200
면역원 서열
CDHPSNTVPSGSNQDLGAGAGEDARSDDSSSRIINGSDCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHCRKKVFRVRLGHYSLSPVYESGQQMFQGVKSIPHPGYSHPGHSNDLMLIKLNRRIRPTKDVRPINVSSH
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... KLK5(25818)
The gene KLK5 (kallikrein related peptidase 5) encodes a serine protease that is a member of the kallikrein gene family. Its expression is abundant in skin, mammary gland and testis. The gene is localized to a gene cluster at human chromosome 19q13.2-q13.4. The encoded protein is synthesized as a preproenzyme containing an N-terminal signal peptide (prezymogen) followed by an activation peptide and the enzymatic domain. It is highly homologous to the enamel matrix serine proteinase 1 (EMSP1).
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|