Merck Anti-IKZF5 antibody produced in rabbit
다른 상품 둘러보기
Anti-IKZF5 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
향상된 검증
recombinant expression
Learn more about Antibody Enhanced Validation
technique(s)
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
western blot: 0.04-0.4 μg/mL
면역원 서열
IKGTRSSLSSKKMWGVLQKKTSNLGYSRRALINLSPPSMVVQKPDYLNDFTHEIPNIQTDSYESMAKTTPTGGLPRDPQELMVDNPLNQLSTLAGQL
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... IKZF5(64376)
IKZF5 (IKAROS family zinc finger 5), also called Pegasus, belongs to the Ikaros family of proteins, and shares the highest homology with Helios protein. It shares its C-terminal dimerization domain with other Ikaros family members, but has differences in its N-terminal, which contains three zinc fingers. It forms homomers as well as heteromers with other family members. It is expressed in hematopoietic cell lines as well as various other cell types. It has a putative molecular weight of 46.5kDa, and an isoelectric point (pI) of 7.27.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제수단 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|