Merck Anti-IKZF5 antibody produced in rabbit

Anti-IKZF5 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies

Affinity isolated antibody, buffered aqueous glycerol solution

---

제품 개요

IKZF5 (IKAROS family zinc finger 5), 일명 Pegasus는 Ikaros 단백질 패밀리에 속하며 Helios 단백질과 높은 상동성을 가집니다. C-말단의 이합체화 도메인은 다른 Ikaros 계열 단백질과 공유하지만, N-말단에는 세 개의 zinc finger가 존재합니다. IKZF5는 혈액세포 계통 및 다양한 세포 유형에서 발현되며, 분자량은 약 46.5 kDa, 등전점(pI)은 7.27입니다.

---

제품 사양

---

적용 기술

• Immunofluorescence: 0.25–2 μg/mL
• Immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
• Western blot: 0.04–0.4 μg/mL

---

면역원 서열

IKGTRSSLSSKKMWGVLQKKTSNLGYSRRALINLSPPSMVVQKPDYLNDFTHEIPNIQTDSYESMAKTTPTGGLPRDPQELMVDNPLNQLSTLAGQL

---

Gene Information

Human IKZF5 (64376)
IKZF5 (IKAROS family zinc finger 5), also called Pegasus, belongs to the Ikaros family of proteins, and shares the highest homology with Helios protein. It shares its C-terminal dimerization domain with other Ikaros family members, but has differences in its N-terminal, which contains three zinc fingers. It forms homomers as well as heteromers with other family members. It is expressed in hematopoietic cell lines as well as various other cell types. It has a putative molecular weight of 46.5 kDa, and an isoelectric point (pI) of 7.27.

---

참고 링크

Learn more about Antibody Enhanced Validation