Merck Anti-SIRT2 antibody produced in rabbit
다른 상품 둘러보기
Anti-SIRT2 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
향상된 검증
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:500-1:1000
면역원 서열
KDKGLLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESLPARFFSCMQSDFLKVDLLL
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... SIRT2(22933)
SIRT2 (sirtuin 2) is a member of a highly conserved protein family called sirtuins. In humans, there are 7 members in this family, from sirtuin1-7. This gene is localized to human chromosome 19q13.2. SIRT2 protein has a helical N-terminal made of 19 amino acids, and a catalytic core made of 304 amino acids. The core region consists of two domains- the larger domain contains a Rossmann fold variant, and the smaller domain contains a zinc atom. This protein resides in the cytoplasm. However, studies show that an alternatively spliced variant of SIRT2, isoform 5, lacks a nuclear export signal and is constitutively localized to the nucleus.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제수단 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|