Merck Anti-DCT antibody produced in rabbit
다른 상품 둘러보기
Anti-DCT antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
향상된 검증
orthogonal RNAseq
independent
Learn more about Antibody Enhanced Validation
technique(s)
immunohistochemistry: 1:200-1:500
western blot: 0.04-0.4 μg/mL
면역원 서열
WSGPYILRNQDDRELWPRKFFHRTCKCTGNFAGYNCGDCKFGWTGPNCERKKPPVIRQNIHSLSPQEREQFLGALDLAKKRVHPDYVITTQHWLGLLGPNGTQPQFANCSVYDF
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... DCT(1638)
DCT (dopachrome tautomerase) belongs to melanocyte/melanoma differentiation antigens (MDA) family. It is a melanoma associated antigen. It contains 519 amino acids and has five isoforms in humans, due to alternative splicing. It contains a putative transmembrane domain, encoded by exon 8, which is essential for its activity. TRP-LT and TRP-2-6b isoforms of DCT are localized to the membrane of melanosomes, and possess dopachrome tautomerase activity. TRP-2-INT2 isoform is a shorter protein with only 237 amino acids. TRP- 2-8b isoform does not contain the transmembrane domain, and hence is devoid of dopachrome tautomerase activity. This gene is located on human chromosome 13q32.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제수단 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|