
Merck Anti-SLC13A2 antibody produced in rabbit
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SLC13A2 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
향상된 검증
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunohistochemistry: 1:500-1:1000
면역원 서열
ATSAMMVPIAHAVLDQLHSSQASSNVEEGSNNPTFELQEPSPQKEVTKLDNGQALPVTSASSEGRAHLSQKHLHLTQCMSLCVCYSASIGGIATLTGTAPNLVLQGQINSLFPQNGNVV
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... SLC13A2(9058)
SLC13A2 (solute carrier family 13, member 2) is a member of the SLC13 family which contains five members. It is a Na+-dicarboxylate cotransporter, present in the kidney. It has two N-glycosylation sites present on its C-terminal. Apart from kidney, the mRNA is also found in intestine. It is present on proximal tubular cells, on their apical sides. It is also called Na+-coupled dicarboxylate transporters 1 (NaDC1), and is one of the two isoforms of NaDC transporters. This gene is present on human chromosome 17, spans ~30kb, and has around 12 coding exons.
🏷️Merck Sigma 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Merck Sigma
Merck Anti-C1GALT1 antibody produced in rabbit
370,530원

Merck Sigma
Merck Anti-SYNJ1 antibody produced in rabbit
370,530원

Merck Sigma
Merck Anti-SLC13A2 antibody produced in rabbit
895,700원

Merck Sigma
Merck Anti-TGOLN2 antibody produced in rabbit
895,700원

Merck Sigma
Merck Anti-TFR2 antibody produced in rabbit
370,530원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
