Merck Anti-PEBP1 antibody produced in rabbit
Merck의 Anti-PEBP1 rabbit polyclonal antibody로, Prestige Antibodies® Powered by Atlas Antibodies 제품입니다. Human PEBP1 단백질에 반응하며 IHC에 적합합니다. −20°C에서 보관하며, 25 μL 소포장으로 제공됩니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PEBP1 antibody produced in rabbit
제품 개요
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution.
생물학적 소스
rabbit
품질 등급
100 (M-Clarity Program)
결합 형태
unconjugated
항체 형태
affinity isolated antibody
항체 유형
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
제형
buffered aqueous glycerol solution
반응 종
human
포장
antibody small pack of 25 μL
향상된 검증
orthogonal RNAseq
자세한 내용은 Antibody Enhanced Validation 참고.
적용 기술
immunohistochemistry: 1:200–1:500
면역원 서열
PTQVKNRPTSISWDGLDSGKLYTLVLTDPDAPSRKDPKYREWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTGLHRYVWLVYEQDRPLKCDEPILSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLY
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
유전자 정보
human PEBP1 (5037)
PEBP1 (phosphatidylethanolamine binding protein 1), also called Raf kinase inhibitory protein (RKIP), is a member of the PEBP class of proteins. This class was initially identified as the class of proteins specifically interacting with phosphatidylethanolamine phospholipid. This class contains two members—PEBP1 and PEBP4. This protein exists in multiple conformations and has a molecular weight of 21 kDa.
제품 스펙 요약
| 항목 | 내용 |
|---|---|
| Biological Source | Rabbit |
| Quality Level | 100 |
| Conjugation | Unconjugated |
| Antibody Form | Affinity isolated antibody |
| Type | Primary, Polyclonal |
| Product Line | Prestige Antibodies® |
| Formulation | Buffered aqueous glycerol solution |
| Species Reactivity | Human |
| Package Size | 25 μL |
| Validation | Orthogonal RNAseq |
| Application | Immunohistochemistry (1:200–1:500) |
| Immunogen Sequence | Provided above |
| UniProt Accession | P30086 |
| Shipping Condition | Wet ice |
| Storage Temperature | −20°C |
| Gene | PEBP1 (5037) |
제품 이미지
(이미지 없음)
🏷️Merck Sigma 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Merck Sigma
Merck Anti-SYT1 antibody produced in rabbit
370,530원
Merck Sigma
Merck Anti-TMEM87A antibody produced in rabbit
895,700원
Merck Sigma
Merck Anti-PEBP1 antibody produced in rabbit
817,800원
Merck Sigma
Merck Anti-HLA-DMA antibody produced in rabbit
370,530원
Merck Sigma
Merck Anti-S100A9 antibody produced in rabbit
370,530원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|