상품 옵션 정보 | ||||||||
---|---|---|---|---|---|---|---|---|
카탈로그 번호 | CAS 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
HPA010638-100UL | - | Merck HPA010638-100UL Anti-GOLM1 antibody produced in rabbit, 100uL pk | 재고문의 | pk | 894,810원 | - | 984,291원 | |
HPA010638-25UL | - | Merck HPA010638-25UL Anti-GOLM1 antibody produced in rabbit, 25uL pk | 재고문의 | pk | 412,760원 | - | 454,036원 |
Anti-GOLM1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
향상된 검증
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:500-1:1000
면역원 서열
GKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESE
배송 상태
wet ice
저장 온도
−20°C
GOLM1 (golgi membrane protein 1) gene is localized to human chromosome 9q21.33 and is expressed normal epithelial cells of tissues, such as the gut, prostate, kidneys, lungs and within the central nervous system. Its expression is observed to be upregulated in liver diseases and in certain cancers such as hepatocellular carcinoma (HCC), prostate cancer, and renal cell cancer. The protein contains a short N-terminal cytoplasmic domain, followed by a transmembrane domain (TMD). It also contains a larger C-terminal domain that faces the Golgi lumen. This domain facing the lumen has a coiled-coil domain and an acid tail capable of mediating protein–protein interactions. The protein has a molar mass of 73kDa and is found to be upregulated by viral infection.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|