Merck Anti-FGF4 antibody produced in rabbit
다른 상품 둘러보기
Anti-FGF4 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
향상된 검증
recombinant expression
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:20-1:50
면역원 서열
VVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFL
UniProt 수납 번호
application(s)
research pathology
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... FGF4(2249)
FGF4 (fibroblast growth factor 4) is a part of FGF family of secreted signaling proteins. FGF family consists of 22 heparin-binding polypeptides. FGF4 conforms in to the β-trefoil fold like other FGF members, and consists of a signal peptide. It was first identified in the screening of Kaposi′s sarcoma and human stomach cancers. This protein is made of 206 amino acids, and contains an N-glycosylation site. This gene is expressed during gastrula and early somite stage embryos, in proximity to the posterior endoderm. In the gut endoderm, it shows an anterior-posterior expression pattern. In adult humans, it is expressed in nervous system, intestines and testis. It is located on human chromosome 11q13.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|