
Merck Anti-CRLF3 antibody produced in rabbit
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CRLF3 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
향상된 검증
RNAi knockdown
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500
면역원 서열
IEHGVNTAEDLVREGEIAMLGGVGEENEKLWSFTKKASHIQLDSLPEVPLLVDVPCLSAQLDDSILNIVKDHIFKHGTVASRPPVQIEELIEKPGGIIVRWCKVDDDFTAQDYRLQFRKCTSNHFEDVYVGSE
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... CRLF3(51379)
CRLF3 (cytokine receptor-like factor 3) gene is mapped to human chromosome 17q11.2 and is found to be frequently deleted in patients with Neurofibromatosis type 1 (NF1) microdeletions in the neurofibromin locus. It is also called as p48.2 based on its predicted molar mass and it encodes a 438aa intracellular protein. It contains a typical fibronectin type III (FNIII) domain. A palindromic Arg-Gly-Asp (RGD) repeat and a putative Trp-Ser-X-Trp-Ser (WSXWS) motif are located at the C-terminus of this domain. Its expression is found to be increased in lung cancer and leukemia cells. It is distributed in both cytoplasm and cell membrane in mammalian cells.
🏷️Merck Sigma 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Merck Sigma
Merck Anti-LETM1 antibody produced in rabbit
895,700원

Merck Sigma
Merck Anti-MTDH antibody produced in rabbit
370,530원

Merck Sigma
Merck Anti-CRLF3 antibody produced in rabbit
895,700원

Merck Sigma
Merck Anti-MAGEC1 antibody produced in rabbit
370,530원

Merck Sigma
Merck Anti-NCF2 antibody produced in rabbit
817,800원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
