상품 옵션 정보 | ||||||||
---|---|---|---|---|---|---|---|---|
카탈로그 번호 | CAS 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
HPA008832-100UL | - | Merck HPA008832-100UL Anti-NFASC antibody produced in rabbit, 100uL pk | 재고문의 | pk | 951,160원 | - | 1,046,276원 |
Anti-NFASC antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
향상된 검증
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunohistochemistry: 1:50- 1:200
면역원 서열
LECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLADQATPTNRLAALPKGRPDRPRDLELTDLAERSVRLTWIPGDANNSPITDYVVQFE
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... NFASC(23114)
NFASC (neurofascin) is a member of the L1 family of CAMs (cell adhesion molecules), which in turn is a part of the immunoglobulin (Ig) superfamily of proteins. It is mainly expressed in the nervous system. The members of L1 family contain six Ig-like domains and four to five Fn (fibronectin) domains in their extracellular region. Their cytoplasmic domain contains a putative conserved motif (FIG(Q/A)Y) that links the proteins to cytoplasm and also facilitates the binding to ankyrin. This protein has multiple spliced isoforms, with two major isoforms called NF155 of 155kDa and NF186 of 186kDa. These isoforms are expressed in the glia and axons respectively.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|