Merck Anti-SEZ6 antibody produced in rabbit
다른 상품 둘러보기
Anti-SEZ6 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
향상된 검증
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunohistochemistry: 1:50- 1:200
면역원 서열
PGDVEHSRRLISSPKFPVGATVQYICDQGFVLMGSSILTCHDRQAGSPKWSDRAPKCLLEQLKPCHGLSAPENGARSPEKQLHPAGATIHFSCAPGYVLKGQASIKCVPGHPSHWSDPPPICRA
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... SEZ6(124925)
SEZ6 (Seizure protein 6 homolog) is a brain-specific gene encoding a novel type seizure-related protein. It is expressed specifically in the cerebrum and the cerebellum of brain. It is a multi-domain containing protein including five copies of short consensus repeat (SCRs) or sushi domain (C3b/C4b binding site), threonine-rich domain, two repeated sequences (similar to CUB domain), one transmembrane domain, and a short cytoplasmic segment in the C-terminus end.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제수단 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|