
Merck Anti-TMEM204 antibody produced in rabbit
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-TMEM204 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
향상된 검증
recombinant expression
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200
면역원 서열
HKREDCMAPRVIVISRSLTARFRRGLDNDYVESPC
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... TMEM204(79652)
The gene TMEM204 (transmembrane protein 204) encodes a four transmembrane spanning protein that is commonly called CLP24 (claudin-like protein of 24kDa). It is found to be homologous to myelin protein 22/epithelial membrane protein 1/claudin family of cell junction proteins. These homologous proteins modulate paracellular permeability. The encoded protein contains a protein-protein interaction domain at the C-terminus. It is abundantly expressed in lung, heart, kidney and placental tissues. It localizes to cell-cell junctions and is found to exist along with the β-catenin adherens junction-associated protein. It does not co-exist with tight junctions.
🏷️Merck Sigma 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Merck Sigma
Merck Anti-ETFA antibody produced in rabbit
895,600원

Merck Sigma
Merck Anti-KAT5 antibody produced in rabbit
370,530원

Merck Sigma
Merck Anti-TMEM204 antibody produced in rabbit
895,700원

Merck Sigma
Merck Anti-CYB5R1 antibody produced in rabbit
895,700원

Merck Sigma
Merck Anti-YARS antibody produced in rabbit
895,600원
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제수단 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|