Merck Anti-LETM1 antibody produced in rabbit
다른 상품 둘러보기
Anti-LETM1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
향상된 검증
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500
면역원 서열
SKTGEEKYVEESKASKRLTKRVQQMIGQIDGLISQLEMDQQAGKLAPANGMPTGENVISVAELINAMKQVKHIPESKLTSLAAALDENKDGKVNIDDLVKVIELVDKEDVHISTSQVAEIVATLE
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... LETM1(3954)
LETM1 (Leucine zipper-EF-hand containing transmembrane protein 1) is a mitochondrial inner membrane protein, and is homologous to yeast protein Mdm38p. It was originally recognized as one of the genes deleted in Wolf-Hirschhorn syndrome. It is a transmembrane protein, which has 14-3-3-like domain in its soluble region, two EF hand Ca2+-binding motifs and two coiled-coil domains. The C-terminal of this protein is hydrophilic and faces the matrix, whereas the N-terminal is hydrophobic and spans the membrane. It has a molecular weight of 83.4kDa. This gene is located on human chromosome 4p16.3.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|