상품 옵션 정보 | ||||||||
---|---|---|---|---|---|---|---|---|
카탈로그 번호 | CAS 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
HPA007922-100UL | - | Merck HPA007922-100UL Anti-UBE2Z antibody produced in rabbit, 100uL pk | 재고문의 | pk | 948,780원 | - | 1,043,658원 |
Anti-UBE2Z antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
mouse, human, rat
포장
antibody small pack of 25 μL
향상된 검증
RNAi knockdown
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500
면역원 서열
ISSVLISIQSLMTENPYHNEPGFEQERHPGDSKNYNECIRHETIRVAVCDMMEGKCPCPEPLRGVMEKSFLEYYDFYEVACKDRLHLQGQTMQDPFGEKRGHFDYQSLLMRLGLIRQKVLERLHNENAEMDS
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... UBE2Z(65264)
UBE2Z (ubiquitin-conjugating enzyme E2Z) gene is mapped to human chromosome 17q21.32 and contains six exons. It is predominantly expressed in placenta, pancreas, spleen and testis and is located both in the nucleus and the cytoplasm. The E2 ubiquitin enzymes contain a 16-18kDa conserved catalytic domain called the UBC domain that functions as an active site for the formation of thiol ester with ubiquitin. UBE2Z encodes a 246-amino acid protein containing one UBC domain at its N-terminus.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|