Merck Anti-MARCH2 antibody produced in rabbit
다른 상품 둘러보기
Anti-MARCH2 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
향상된 검증
recombinant expression
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:20-1:50
면역원 서열
RYHCQLYSEWRKTNQKVRLKIREADSPEGPQHSPLAAGLLKKVAEETPV
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... MARCH2(51257)
The gene MARCH2 (membrane associated ring-CH-type finger 2) encodes a membrane-bound E3 ubiquitin ligase that belongs to the MARCH (Membrane-associated RING-CH) family of proteins. These proteins contain conserved PDZ (PSD-95, Dlg1, ZO-1) binding motifs. MARCH2 is ubiquitously expressed and it localizes to endosomal vesicles and the plasma membrane. The gene is mapped to human chromosome 19p13.2.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|