
Merck Anti-PAK1 antibody produced in rabbit
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PAK1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human, mouse, rat
포장
antibody small pack of 25 μL
향상된 검증
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500
면역원 서열
NSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEE
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... PAK1(5058)
PAK1 (p21 activated kinase 1) is a Ser/Thr kinase protein, and is a member of the evolutional conserved PAKs, which consists of six members. PAKs are divided into two groups- group I and II. PAK1 is a part of group I PAK, and has a wide range of tissue expression. Its GTPase binding domain (GBD) is present in the N-terminal, which also contains the autoinhibitory domain (AID). The N-terminal also contains five classical proline-rich regions (PXXP), which aid in protein-protein interaction. Its Ser/thr kinase domain is present in its C-terminal.
🏷️Merck Sigma 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Merck Sigma
Merck Anti-ZBED6CL antibody produced in rabbit
895,700원

Merck Sigma
Merck Anti-CARS antibody produced in rabbit
895,600원

Merck Sigma
Merck Anti-PAK1 antibody produced in rabbit
370,530원

Merck Sigma
Merck Anti-RPN2 antibody produced in rabbit
895,700원

Merck Sigma
Merck Anti-CCDC90B antibody produced in rabbit
895,700원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
