Merck Anti-YIPF3 antibody produced in rabbit
상품 옵션 정보 | |||||||||
---|---|---|---|---|---|---|---|---|---|
카탈로그 번호 | CAS 번호 | 설명 | 상태 | 재고 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
HPA014859-100UL | - | Merck HPA014859-100UL Anti-YIPF3 antibody produced in rabbit, 100uL pk | 재고문의 | 0 | pk | 895,700원 | - | 985,270원 |
다른 상품 둘러보기
Anti-YIPF3 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
향상된 검증
recombinant expression
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:20-1:50
면역원 서열
GILDTLEGPNIPPIQRVPRDIPAMLPAARLPTTVLNATAKAVAVTLQSH
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... YIPF3(25844)
YIPF3 (Yip1 domain family, member 3) is a member of the Yip1 domain family (YIPF), and is a homolog of human Yif1p. It is synthesized in the endoplasmic reticulum (ER) as an N-glycosylated 40kDa protein, which is O-glycosylated to 46kDa protein in the Golgi bodies. Eventually it is cleaved at its luminal C-terminal to produce a 36kDa protein. This protein resides in the _cis_-Golgi, where it forms a complex with YIPF4. It is a membrane protein, with five transmembrane domains, and is composed of 350 amino acids. This gene is localized to human chromosome 6p21.1-6p21.2, and has nine exons.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|