Merck Anti-FARS2 antibody produced in rabbit
다른 상품 둘러보기
Anti-FARS2 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
향상된 검증
recombinant expression
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:20-1:50
면역원 서열
GTPLFSVYDNLSPVVTTWQNFDSLLIPADHPSRKKGDNYYLNRTHMLRAHTSAHQWDLLHAGLDAFLVVGDVYRRDQIDSQHYPIFHQLEAVRLFSKHELFAGIKDGES
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... FARS2(10667)
The gene Phenylalanyl-tRNA synthetase (FARS2) has been mapped to human chromosome 6p25.1. Three isoforms of phenylalanyl-tRNA synthase exist: the bacterial (αβ)2 heterodimer, the archaeal/eukaryotic cytosolic (αβ)2 heterodimer and the mitochondrial monomer. The human mitochondrial phenylalanyl-tRNA synthetase (FARS2) consists of a single polypeptide chain and is the smallest known nuclear-encoded synthetase. The protein has four major domains: an N-terminal region, a catalytic domain, a linker region and a C-terminal domain.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제수단 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|