Merck Anti-BCAR3 antibody produced in rabbit
다른 상품 둘러보기
Anti-BCAR3 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
향상된 검증
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:20-1:50
면역원 서열
SPLAEHRPDAYQDVSIHGTLPRKKKGPPPIRSCDDFSHMGTLPHSKSPRQNSPVTQDGIQESPWQDRHGETFTFRDPHLLDPTVEYVKFSKERHIMDRTPEKLKKEL
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... BCAR3(8412)
BCAR3 (breast cancer anti-estrogen resistance 3) belongs to the SH2 domain-containing protein (NSP) family. In humans, this family contains three members namely, NSP1, NSP2/BCAR3 and NSP3. BCAR3 shows high homology to Cdc25 family of Rac GEFs, and contains a GEF (GDP-exchange factor)-like domain in its C-terminal. It also contains an SH2 domain, and a proline/serine-rich domain. It was first described in two estrogen-dependent human breast cancer cell lines, as the gene responsible for anti-estrogen resistance. It has a molecular weight of 95kDa.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제수단 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|