Merck Anti-SPINK5 antibody produced in rabbit
다른 상품 둘러보기
Anti-SPINK5 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
향상된 검증
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500
면역원 서열
QQEERARAKAKREAAKEICSEFRDQVRNGTLICTREHNPVRGPDGKMHGNKCAMCASVFKLEEEEKKNDKEEKGKVEAEKVKREAVQELCSEYRHYVRNGRLPC
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... SPINK5(11005)
SPINK5 (serine protease inhibitor Kazal-type 5) is a secreted multi-domain serine protease inhibitor. It is expressed in hair follicles in the inner root sheets and in the epidermis in the granular layer. This protein contains 15 serine protease inhibitor domains. It is composed of 1064 amino acids, and has a signal peptide. It is synthesized as a pro-protein, which is cleaved into different isoforms. Three isoforms of this protein exist- a short isoform with only the first 13 domains, the 15 domain isoform, and a long isoform with a 30 amino acid stretch inserted between domains 13 and 14. The molecular weight of 15 domain isoform is ~120kDa. SPINK5 gene is localized to human chromosome 5q32, and is made of 33 exons.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제수단 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|