Merck Anti-SGMS2 antibody produced in rabbit
Merck의 Anti-SGMS2 rabbit polyclonal 항체로, 인간 SGMS2 단백질을 인식합니다. Prestige Antibodies® 라인 제품이며, immunoblotting과 immunohistochemistry에 적합합니다. −20°C 보관, buffered glycerol 용액 형태로 제공됩니다.
- 카탈로그번호
- HPA015076-100UL
- 브랜드
- Merck Sigma
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Merck Sigma · Merck Anti-SGMS2 antibody produced in rabbit
Anti-SGMS2 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
제품 정보
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| Quality Level | 100 |
| 결합 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| Antibody Product Type | Primary antibodies |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 형태(Form) | Buffered aqueous glycerol solution |
| Species Reactivity | Human |
| 포장 | Antibody small pack of 25 μL |
| 향상된 검증 | Orthogonal RNAseq |
| Technique(s) | Immunoblotting: 0.04–0.4 μg/mL Immunohistochemistry: 1:200–1:500 |
| 면역원 서열 | IIETAKLEEHLENQPSDPTNTYARPAEPVEEENKNGNGKPKSLSSGLRKGTKKYPDYIQIAMPTESR |
| UniProt 수납 번호 | Q8NHU3 |
| 배송 상태 | Wet ice |
| 저장 온도 | −20°C |
Gene Information
SGMS2 (sphingomyelin synthase 2)
SGMS2, also called SMS2, is one of two isoforms of the sphingomyelin synthase (SMS) enzyme, the last enzyme in the sphingomyelin (SM) synthesis pathway. SMS1, SMS2, and SMSr form the complete SMS family.
SGMS2 resides in the plasma membrane, and its cytoplasmic C-terminal is palmitoylated at cysteine residues. It contains four conserved motifs (D1, D2, D3, D4) and six transmembrane α-helices. The D1 motif is located in the first exoplasmic loop, and D2 in the third transmembrane α-helix.
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.