Merck Anti-CCAR2 antibody produced in rabbit
상품 옵션 정보 | |||||||||
---|---|---|---|---|---|---|---|---|---|
카탈로그 번호 | CAS 번호 | 설명 | 상태 | 재고 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
HPA019943-100UL | - | Merck HPA019943-100UL Anti-CCAR2 antibody produced in rabbit, 100uL pk | 재고문의 | 0 | pk | 817,800원 | - | 899,580원 |
다른 상품 둘러보기
Anti-CCAR2 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab2
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
향상된 검증
orthogonal RNAseq
independent
Learn more about Antibody Enhanced Validation
technique(s)
immunohistochemistry: 1:2500-1:5000
western blot: 0.04-0.4 μg/mL
면역원 서열
RSVASNQSEMEFSSLQDMPKELDPSAVLPLDCLLAFVFFDANWCGYLHRRDLERILLTLGIRLSAEQAKQLVSRVVTQNICQYRS
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... KIAA1967(57805)
KIAA1967 is a large multi-domain containing nuclear protein mapped on chromosomal location 8p22. It consists of a NL (nuclear localization) motif, a CC (coiled-coil) domain responsible for the protein-protein interaction, an inactive EF-hand for Ca2+ binding, a Nudix domain, a RNA-binding domain and an LZ (leucine zipper) motif.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|