Merck Anti-HEXDC antibody produced in rabbit
Merck의 rabbit 유래 Anti-HEXDC polyclonal antibody로, Prestige Antibodies® Powered by Atlas Antibodies 제품입니다. 인간 HEXDC 단백질 검출에 적합하며, immunoblotting, immunofluorescence, immunohistochemistry 등에 사용 가능합니다. −20°C에서 보관하며 recombinant expression으로 향상된 검증을 거쳤습니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-HEXDC antibody produced in rabbit
제품 개요
Prestige Antibodies® Powered by Atlas Antibodies 시리즈로, rabbit에서 생산된 affinity isolated polyclonal antibody입니다. Buffered aqueous glycerol solution 형태로 제공됩니다.
생물학적 정보
| 항목 | 내용 |
|---|---|
| Biological Source | Rabbit |
| Quality Level | 100 |
| Conjugation | Unconjugated |
| Antibody Form | Affinity isolated antibody |
| Product Type | Primary antibodies |
| Clone | Polyclonal |
| Product Line | Prestige Antibodies® Powered by Atlas Antibodies |
| Form | Buffered aqueous glycerol solution |
| Species Reactivity | Human |
| Packaging | Antibody small pack of 25 μL |
| Enhanced Validation | Recombinant expression |
| UniProt Accession | Q8WVB3 |
| Shipping Conditions | Wet ice |
| Storage Temperature | −20°C |
적용 기술 (Applications)
| Technique | Recommended Concentration |
|---|---|
| Immunoblotting | 0.04–0.4 μg/mL |
| Immunofluorescence | 0.25–2 μg/mL |
| Immunohistochemistry | 1:50–1:200 |
면역원 서열
ASAFKGATGPSQAVPPVEHHLRNHVQWLQVAGSGPTDSLQGIILTGWQRYDHYSVLCELLPAGVPSLAACLQLLLRGGFDEDVKAKVEN
유전자 정보
Gene: HEXDC (284004)
The gene HEXDC (hexosaminidase D) encodes a protein that is mainly expressed within human arthritic joints. It has been detected in rheumatoid arthritis and osteoarthritis synovial fibroblasts. The gene is mapped to human chromosome 17q25.3. The protein shows nucleocytoplasmic localization and is a member of glycosyl hydrolase family 20.
제품 이미지
(이미지 없음)
🏷️Merck Sigma 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Merck Sigma
Merck Anti-LRRC45 antibody produced in rabbit
895,700원
Merck Sigma
Merck Anti-DUS1L antibody produced in rabbit
895,700원
Merck Sigma
Merck Anti-HEXDC antibody produced in rabbit
817,800원
Merck Sigma
Merck Anti-BRF2 antibody produced in rabbit
895,700원
Merck Sigma
Merck Anti-ECM1 antibody produced in rabbit
370,530원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|