Merck Anti-HEXDC antibody produced in rabbit
Merck의 rabbit 유래 Anti-HEXDC polyclonal antibody로, Prestige Antibodies® Powered by Atlas Antibodies 제품입니다. 인간 HEXDC 단백질 검출에 적합하며, immunoblotting, immunofluorescence, immunohistochemistry 등에 사용 가능합니다. −20°C에서 보관하며 recombinant expression으로 향상된 검증을 거쳤습니다.
- 브랜드
- Merck Sigma
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Merck Sigma · Merck Anti-HEXDC antibody produced in rabbit
Anti-HEXDC antibody produced in rabbit
제품 개요
Prestige Antibodies® Powered by Atlas Antibodies 시리즈로, rabbit에서 생산된 affinity isolated polyclonal antibody입니다. Buffered aqueous glycerol solution 형태로 제공됩니다.
생물학적 정보
| 항목 | 내용 |
|---|---|
| Biological Source | Rabbit |
| Quality Level | 100 |
| Conjugation | Unconjugated |
| Antibody Form | Affinity isolated antibody |
| Product Type | Primary antibodies |
| Clone | Polyclonal |
| Product Line | Prestige Antibodies® Powered by Atlas Antibodies |
| Form | Buffered aqueous glycerol solution |
| Species Reactivity | Human |
| Packaging | Antibody small pack of 25 μL |
| Enhanced Validation | Recombinant expression |
| UniProt Accession | Q8WVB3 |
| Shipping Conditions | Wet ice |
| Storage Temperature | −20°C |
적용 기술 (Applications)
| Technique | Recommended Concentration |
|---|---|
| Immunoblotting | 0.04–0.4 μg/mL |
| Immunofluorescence | 0.25–2 μg/mL |
| Immunohistochemistry | 1:50–1:200 |
면역원 서열
ASAFKGATGPSQAVPPVEHHLRNHVQWLQVAGSGPTDSLQGIILTGWQRYDHYSVLCELLPAGVPSLAACLQLLLRGGFDEDVKAKVEN
유전자 정보
Gene: HEXDC (284004)
The gene HEXDC (hexosaminidase D) encodes a protein that is mainly expressed within human arthritic joints. It has been detected in rheumatoid arthritis and osteoarthritis synovial fibroblasts. The gene is mapped to human chromosome 17q25.3. The protein shows nucleocytoplasmic localization and is a member of glycosyl hydrolase family 20.
제품 이미지
(이미지 없음)
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.